By Brian Golding and Dick Morton

Show description

Read or Download Brian sequence analysis PDF

Similar bioinformatics books

Microarray Technology Through Applications

Microarray know-how via purposes offers the reader with an knowing, from an purposes point of view, of the various variety of options required to grasp the experimental and knowledge research points of microarray expertise. the 1st chapter is a concise creation to the know-how and offers the theoretical historical past required to appreciate the following sections.

The DNA Mystique: The Gene as a Cultural Icon (Conversations in Medicine and Society)

"The DNA Mystique is a serious warning call to all who could brush off America's love affair with 'the gene' as a basically eccentric obsession. "--In those Times"Nelkin and Lindee are to be warmly congratulated for establishing up this fascinating box [of genetics in pop culture] to extra examine. "--NatureThe DNA Mystique means that the gene in pop culture attracts on clinical principles yet isn't limited through the technical definition of the gene as a bit of DNA that codes for a protein.

Medical And Care 3 (Studies in Health Technology and Informatics) (Studies in Health Technology and Informatics)

This e-book covers features pertaining to details provide to sufferer undefined; digital overall healthiness documents, its criteria, its social implications; and new advancements in scientific & care compunetics. For citizen / patient-related info, it's important to take advantage of the newest clinical and care compunetics.

Bioinformatics Software Engineering: Delivering Effective Applications

Content material: bankruptcy 1 What you want to understand (pages 1–7): bankruptcy 2 what's software program Engineering? (pages 9–13): bankruptcy three undertaking Definition (pages 15–20): bankruptcy four standards catch (pages 21–31): bankruptcy five isolating functionality, Interface and Implementation (pages 33–38): bankruptcy 6 Implementation issues (pages 39–44): bankruptcy 7 evidence of proposal, Prototyping and purchase?

Additional info for Brian sequence analysis

Example text

Uk or check their web site. J. For the particular entry chosen in Example #1, the DDBJ format is essentially equivalent (there are minor differences). It is ... Example Entry #4: DDBJ - HUMCKRASA LOCUS DEFINITION ACCESSION KEYWORDS SOURCE ORGANISM REFERENCE AUTHORS TITLE JOURNAL STANDARD FEATURES CDS HUMCKRASA 450 bp ss-mRNA PRI 15-SEP-1990 Human PR310 c-K-ras protein mRNA, 5’ end. M35504 c-K-ras protein; c-myc oncogene. Human (patient PR310) lung carcinoma, cDNA to mRNA. Homo sapiens Eukaryota; Animalia; Metazoa; Chordata; Vertebrata; Mammalia; Theria; Eutheria; Primates; Haplorhini; Catarrhini; Hominidae.

Eukaryotae; mitochondrial eukaryotes; Metazoa; Chordata; Vertebrata; Eutheria; Rodentia; Sciurognathi; Myomorpha; Muridae; Murinae; Mus. 7‘ /note=‘purine salvage enzyme‘ /codon_start=1 /product=‘adenine phosphoribosyltransferase‘ /db_xref=‘PID:g881576‘ /translation=‘MSEPELKLVARRIRSFPDFPIPGVLFRDISPLLKDPDSFRASIR LLASHLKSTHSGKIDYIAGLDSRGFLFGPSLAQELGVGCVLIRKQGKLPGPTVSASYS LEYGKAELEIQKDALEPGQRVVIVDDLLATGGTMFAACDLLHQLRAEVVECVSLVELT SLKGRERLGPIPFFSLLQYD‘ BASE COUNT 413 a 652 c 564 g 488 t" sequence "TCGGGATTGACGTGAATTTAGCGTGCTGATACCTACCTCCTCCTT GCCTCCTACACGCACGCGGCCATGTCCGAACCTGAGTTGAAACTGGTGGCGCGGCGCATC CGCAGCTTCCCCGACTTCCCAATCCCGGGCGTGCTGTTCAGGTGCGGTCACGAGCCGGCG AGGCGTTGGCGCCGTACGCTCATCCC-CCGGCGCAGGCGCGTAGGCAGCCTCGGGGATCT TGCGGGGCCTCTGCCCGGCCACACGCGGGTCACTCTCCTGTCCTTGTTCCCAGGGATATC TCGCCCCTCTTGAAAGACCCGGACTCCTTCCGAGCTTCCATCCGCCTCTTGGCCAGTCAC CTGAAGTCCACGCACAGCGGCAAGATCGACTACATCGCAGGCGA--GTGGCCTTGCTAGG CCGTGCTCGTCCCCCACGGTCCTAGCCCCTATCCCCTTTCCCCCTCGTGTCACCCACAGT CTGCCCCACACCCATCCATTCTTTCTTCAACCTCTGACACTTCCTCCTTGGTTCCTCACT GCCTTGGACGCTTGTTCACCCCGGATGAACTATGTAGGAGTCTCCCTTCCCTGCTAGGTA CCCTAAGGCATCTGCCCTCGGTGCTTGTTCCTAGAGACGAACTCTGCTCT" } { name "GCU28961" type "DNA" longname Gerbillus campestris sequence-ID "U28961" descrip "Gerbillus campestris adenine phosphoribosyltransferase (APRT) gene," creator "Yazdani,F.

In addition to each of these major databases, there are databases on each of the organisms that have major genomics projects - E. coli, Yeast, Arabidopsis, Mouse, Aspergillus & Bovine, Drosophila, Caenorhabditis elegans (from France, or from North America), Fungi, Maize, Rice, Mycobacterium, HIV, and so on. There are many other databases on diverse aspects (some have been taken from the PDB but there are many sources for these) such as the CEPH-Genethon human physical map data from Michigan (or France); a human cDNA database; a human expressed gene anatomy database EGAD; several human genome sequencing centers such as Baylor College of Medicine and the Sanger Center; Agricultural Genome Information; the National Biomedical Research Foundation’s NRL3D database derived from the 3D protein structures at the Brookhaven National Laboratories; an immunogenetics database IMGT; the Database of Expressed Sequence Tags dbEST; the Database of Sequence Tagged Sites dbSTS; the Eukaryotic Promoter Database EPD; a database of 3Ddiagrams of proteins; BMRB (BioMagResBank); CCDC (Cambridge Crystallographic Data Centre); ExPASy Molecular Biology Server; HIC-Up (Hetero-compound Information Centre Uppsala); HIV Protease Database; Klotho: Biochemical Compounds Declarative Database; Library of Protein Family Cores; Crystal MacroMolecule Files at EBI; NDB (Nucleic Acid Database); Prolysis: A Protease and Protease Inhibitor Web Server; Protein Kinase Database Project; Protein Motions Database; RELIBase; SCOP: Structural Classification of Proteins; Elementary Sequence Analysis 32 edited by Brian Golding and Dick Morton Sept 2000 CATH Protein Structure Classification; Enzyme Structures Database; PDBsum; the PredictProtein server which can generate multiple sequence alignments, predict secondary structure, predict residue solvent accessibility, predict transmembrane helices, predict topology of transmembrane proteins, and this list goes on and on (more later on about how to find what you are interested in).

Download PDF sample

Download Brian sequence analysis by Brian Golding and Dick Morton PDF
Rated 5.00 of 5 – based on 29 votes